PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10430220g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 374aa    MW: 41760.8 Da    PI: 4.6482
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10430220g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT +Ed++lv +++++G g+W++ ++  g+ R++k+c++rw +yl
  MA_10430220g0010 14 KGPWTLDEDQILVSYINKHGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding47.34.8e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++++eE++ ++++ ++ G++ W+tIa++++ gRt++++k+ w+++l
  MA_10430220g0010  67 RGNFSPEEEDHIIKLNQLIGNR-WSTIASHLP-GRTDNEIKNVWNTHL 112
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129422.777965IPR017930Myb domain
SuperFamilySSF466891.01E-3010108IPR009057Homeodomain-like
SMARTSM007174.7E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001672.73E-111661No hitNo description
Gene3DG3DSA:1.10.10.608.5E-2665116IPR009057Homeodomain-like
SMARTSM007171.7E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129417.59866116IPR017930Myb domain
PfamPF002491.8E-1367112IPR001005SANT/Myb domain
CDDcd001675.06E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MGRAPCCDKM GVKKGPWTLD EDQILVSYIN KHGHGNWRAL PKQAGLLRCG KSCRLRWTNY  60
LKPDIKRGNF SPEEEDHIIK LNQLIGNRWS TIASHLPGRT DNEIKNVWNT HLKKRLARMK  120
AEAEAESVAV HAQPAPSSSL DSSTAEMAYH GSNPLSSQIL CNSDARAPSA WEICDPVYVL  180
PELSEDIISS SYNMCRSTID DQSTSTDSIL DVLHSDCIDS LELEIDHSRL SINTLDELQC  240
QPLSRDLQIF IGNDRNNFED PAGVPAISQD EKAEMVTSSS QGMRSDCDGE IVISEESLKS  300
SMNLRVDSLV QQLDGAEVDW FLDHLDNMSP AMDSNHLNKN TVNLCRTDLE AGDGMDYWLN  360
LLRQVQPLPL IQLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6010750.0EF601075.1 Picea glauca R2R3-MYB transcription factor MYB12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA5JYF60.0A5JYF6_PICGL; R2R3-MYB transcription factor MYB12
STRINGfgenesh2_kg.3__2539__AT3G23250.11e-68(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-70myb domain protein 15